Description

RT 10mg, 20mg, 30mg

CAS Number: 2381089-83-2

Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈
Molecular Weight: ~4731.3 g/mol

Sequence (linear representation):
YAQGTFTSDYSILLDKKAQAFIEYLLEGGPSSGAPPPS

99+% Purity (HPLC verified)

• Lyophilized powder
• Storage (Lyophilized): Keep the lyophilized peptide at –20 °C in a dry, desiccated environment to maintain stability.
• After Reconstitution: Store the reconstituted peptide at 2–8 °C and plan to use it within 30 days.
• Reconstitution: Reconstitute using sterile bacteriostatic water or another suitable buffer selected according to your experimental requirements.